pharmacy research topics philippines

By

pharmacy research topics philippines

Pharmacies will be notified if … Sintor, Ma. Completed Thesis Projects 2020. The Bachelor of Science in Pharmacy (BS Pharmacy) is a four-year degree program in the Philippines that is concerned with drugs and other related substances. Last time we checked, there were no pharmacy-related courses on TESDA’s course offering yet. Cabiliza, C.G. Lim, R.A. 2013; 3 (12); 1-8 www.ijpijournals.com, Preformulation, Pharmacokinetic and Stability Studies on the Lyophilized Fruit Juice of Morinda citrifolia (Rubiaceae), IJPI’s J. Pharmaceutics & Cosmetology 2013; 3 (12); 1-9  www.ijpijournals.com, Assessment, Inventory and Ethnobotanical Survey of Medicinal Plants in Batan and Sabtang Island (Batanes Group of Islands, Philippines), Int. Cortuna, Nadia Czarina Mae S., De Guzman, Liza Marie C., Alcaraz, Paul Alper G., Aquino, Rommel Jr., C., Bulaong, Karen G., and Manalili, Bea Abigail G. The Potential Cardioprotective Property of Oil from the Liver of Yellowfin Tuna (Thunnus albacares, Fam. Scombridae) in Isoproterenol Induced Myocardial Infarction in Male Sprague Dawley Rats. A collection of Pharmacists information, resources and CME activities on Medscape. , How to Choose the Right Course in College. As I reviewed my 10 trends today, I felt pretty comfortable with what I suggested. 13 NOV 2020 11:29. Facebook Page: PRRS - Pharmacy Review and Research Services prrs.philippines@gmail.com pharmacyreview.researchservices@yahoo.com 0967. Family Solanaceae) Laves, European Journal of Biomedical and Pharmaceutical Sciences, The Study of the Antimocrobial Property of Fixed Oil from the Different Speicies of Cucurbitaceae Family, Formulation of antibacterial ointment from the ethanoloic crude extract of ikmo leaves (Piper betle Linn. I.G.Arcegono, N.I.Arcullo, M.M.Biscocho, J.Firmalino, R.A.Magnaye, Predictive Validity of Pharmacy Seminar and Pharmacy Review on the Pharmacy Licensure Examination Performance of CEU, Manila Graduates. Below is a continuation of this review with several more active areas of research added to the list, and some extended commentaries on the trends outlined above -- where relevant. Centro Escolar University. Medicine is a very broad topic to write a research paper about. Rubin de Celis, Amelia, Profile of CEU, Manila BS Pharmacy Graduates in June 2010 Pharmaceutical Board Examination. 20 NOV 2020 16:10. Pentinio, R.M. By enrolling in this program you will learn how to develop and manufacture drugs for the diagnosis, prevention, and treatment of diseases; how to manage pharmacies, and how to assist patients with health and drug-related concerns. McAleenan, Jean (2013). 2014; 2 (4), 147-154, The Preference of Butterflies for Nectarine Food Plants, Int. Good evening! Adoption of Artificial Intelligence (AI) by pharma and biotech Pharm*, Profile of Pharmacist Licensure Examination Results in June 2013, Comparison of the Light Resistance Capacity of the Different Primary. The Bachelor of Science in Pharmacy (BS Pharmacy) is a four-year degree program in the Philippines that is concerned with drugs and other related substances. Res. you have a good quality school I hope I enroll in your school this coming june.. We’re not really an educational institution, but We wish you luck on your future plans. Please email our academic staff to discuss potential HDR projects and ask if they are available as an advisor for your proposed HDR program. Ian Freeman — The Association between Patient Characteristics and Use of Statin and Metformin among Elderly Women with Breast Cancer and Diabetes. Name of Refereed Journal where Research was published, Evaluation of the Nootropic Activity of the Methanolic Extract of Takip-Kohol (Centella asiatica) Leaves using Morris Water Maze Cognitive Model, PPhA National Convention Bacolod City, April 23-25, 2015, 3rd Philippine Pharmacist Summit UP Diliman (*Champion – Best in Poster Presentation), February 2015, The Lifestyle and Living Situation of Pharmacy Students of Centro Escolar University Manila:  It’s Effect on Academic Performance. Bascos, T., : A preliminary investigation, Journal of Asian Association of Schools of Pharmacy JAASP 2016;1:1, Wound Healing of the Formulated Silver Chitosan Nanocomposite Cream Against Alloxan-Induced Diabetic Wounded Animal Model, Open Access Journal of Pharmaceutical Research Medwin, The Nootropic Activity of Semi-Purified Flavonoids of Mutha (Cyperus rotunda Family Cyperaceae) Tubers in Scopolamine-Induced Amnesia (In Male Sprague-Dawley Rats), 5th Pharmacy Research Forum Research Publication: Benefits, Challenges and Ethical Considerations", Assessment of Lead and Arsenic in Human Blood resulting from Nail Polish Exposure, A Comparative Study in the Calcium Content of the Shells of Oyster (Crassostrea Echinata), Green Shell (Perna Viridis), Capiz Shell (Placuna Placenta), and Nylon Shell (Callista Erycina) from Panay Island, Philippines, International Journal of Applied Pharmaceutical and Biological Research, A Comparative Study In The Calcium Content Of The Shells Of Oyster (Crassostrea Echinata), Green Shell (Perna Viridis), Capiz Shell (Placuna Placenta), And Nylon Shell (Callista Erycina) From Panay Island, Philippines, Oral Presentation & POSTER PRESENTATION: 3rd Philippine Pharmacist Summit UP Diliman, *Champion – Poster Presentation, Preparation, Characterization and In-Vitro Studies of Niosome-Containing Tobramycin for Ophthalmic Targeted Drug Delivery, Oral Presentation: PPhA National Convention 2015 Bacolod City, Hyaluronic Acid Coated Chitosan-Latanoprost-Link Nanoparticle for Prolonged Ocular Drug Delivery, The Effect of Pectin from Citrus grandis as Adhesive on Retention of Maxilliary Denture, International Center of La Consolacion University Philippines, Malolos, Bulacan, The Hair Growth Stimulating Activity of the Semi-Purified Flavonoids from the Stems of Equisetum hyemale Linn. The ASHP Research and Education Foundation (“the Foundation”) is pleased to present the eighth edition of the annual Pharmacy Forecast.We are again pleased to disseminate the Pharmacy Forecast through AJHP, providing readers with easy access to the report.The editorial staff of AJHP has provided substantial support for this publication, and we appreciate their assistance. Matulac, J., Chacon, N.O., Pilao, S.J., and Lee, J.C. Chacon, Naya O. Such a vibrant and dynamic field is bound to produce some great research questions. Lopos, A.C. Yu, Profile of CEU, Manila BS Pharmacy Graduates in January 2010 Pharmaceutical Board Examination. Key Words: clinical pharmacy, research funding, research training, pharmacist-researchers, clinical pharmacy scientist. Adarayan, Ressie B.; Aquino, Miriam Maura A.; Aragon, Althea Yvane G.; Inocencio, John Phillip DI. Mary Jane C. Cruz, RPh., MS Pharm., Glenda Y. Tubon, MS Math,  Sonia Janice l. Pilao, MA Psych.Learni Magdalena Bautista, RPh, PhD Pharm., Determination of the Wound Healing Effect of the Formulated Cream from the Semi-Purified Tannin Extract of Niyog-Niyogan http://www.courses.com.ph/frequently-asked-questions-shifting-to-a-new-course/. It gives the students countless possibilities to investigate treasures of the science of health care from the ancient ages to modern times and even the future. 2019, 13 (Suppl 7): PPP14, ISSN:  1753-6561 MBC Proceedings 2019, 13 (Suppl 7): PPP15, POSTER PRESENTATION: PPhA National Convention Bacolod City, POSTER PRESENTATION: PPhA National Convention Bacolod City    April 23-25, 2015, The Hepatoprotective Property of Commercially Available Ursodeoxycholic acid and Carnitine orotate on Paracetamol-induced Hepatotoxicity: I am confused between pharma or nursing. The Cytotoxic Activity of the Flavonoids Extract from the Seeds of rambutan (Nephelium lappaceum)  Family SAPINDACEAE using Brine Shirmp Toxicity. Pure Appl. Investigating the views of service users on needle exchange in an Irish community pharmacy setting. Gusto ko pong mag-aral ng BS Pharmacist course. De Lara, Ma. The problem of formalizing human skills and capabilities in artificial intelligence objects. Pharmaceutical leech jar, 19th century. Physicochemical Characterization Of Jatropha curcas L. Seed Oil From Bulacan, Philippines. Lean Thinking or Systems Approaches (Six sigma, PDCA, Kaizen in Pharmacy Practice) 5. http://www.courses.com.ph/online-courses-in-the-philippines/. 5100 / 0910. Dela Luna, LAL; Juico, MLV; Marcos, MKR; Yu, MES; Tobongbanua, JM; Incidence of Adverse Drug Reactions in Hospitalized Patients: Dela Luna, LA; Andaya, B; Yu, ME; Tobongbanua, J; Yonah, D; Reotita, D; Labuguen, E; Tumali, A, Knowledge, Attitudes and Practices of Parents in an Urban Community (Brgy. 2012;2 (2); 26-35 www.ijpfr.com, Comparative Hypoglycemic Properties between the Lyophilized Fruit Juice of Morinda citrifolia L. (Rubiaceae) and Lyophilized Commercial Noni Juice in Alloxan-Induced Diabetic Rats, IJPI’s J. Pharmacol. We haven’t come across one yet, but we’re not really sure about that. Delivery: A Key for Prepared Quality Service, Bulacan Medical Center Pediatric Department Employees Arao, C.R.C. Try the open universities on the link below. Bermundo, Kayl Jan B., Guerrero, Geselle Ann R., Ignacio, Cherry Mae B.. Onia, Krizza Ann L., Roxas, Mickee P., Andal, Mylene, R.Ph., MS Pharm . Having a comprehensive list of topics for research papers might make students think that the most difficult part of work is done. Astrero, Adel, Apilan, George Gunter C., Hernandez, Maricar M.,  Masanque, Janince P., Pe, Pia Ysabelle S. The Chemopreventive Potential of Crude Leaf Extract of Pak-choi (Brassica rapa L. cv. A Survey on Bulacan Medical Centers Pediatric Department Employees Perceived Satisfaction Based on Hospital Facilities and Services Family Alliaceae, Dizon, Mary Paoline S., Maglanque, Bryan G., Manzano, Kristel Irish C., Mejia, Mharl Verlyn R., Salapare, Kristia D., Sicat, Ma. Bacay, Dante Jr. R., Cachola, Charles Emanuel V., Jallorina, Kesther Mark D., Evaluation of a pharmacy based winter flu vaccination service. For any inquiry, please do not hesitate to reach us. Asoudeh, Hadi, Bernardo, Jorielyn C., Fallaria, Dee  C., Hadap, Mark Bryan M., 744. All articles posted on this website are the intellectual property of Courses.com.ph. Sonam Nair — Facilitators and Barriers to Biosimilar Adoption: A Systematic Review of the Global Stakeholder Perspective. Evaluation of the Antihyperuricemic Activity of Glucosamine From Selected Species of Crab Shells in 6-Mercaptopurine Induced Hyperuricemic Rats, Awareness of Filipino Community Pharmacists  on Immunization The Nootropic Activity Of The Methanolic Extract Of Centella Asiatica  Linn, Leaves In Scopolamine-Induced  Amnesiac Mice Using Morris Water Maze Cognitive Model. Toxicol. Pilao, Sonia Janice (Pharmacotherapy 2006;26(7):1027–1040) ... of pharmacy has been the topic of several thoughtful articles. I just want to ask if i will take the pharmacy course, how long will it take? 13 NOV 2020 10:09. Pharm, Bautista, Learni Magdalena A, Ph.D.in Pharmacy, Workforce Projections 2010-2020: Annual Supply And Demand Forecasting Model For Pharmacists Across The Philippines. “Pharmacists play a crucial role in the effective delivery of health services… I am a registered nurse. Create a free account to access exclusive CME content, conference listings & more. J. Park, C.R. Hi Im a RN and i would like to be a Registered Pharmacist.. Can I ask what are the requirements??? Reylene Paula M., Delos Santos, Jennelyn P., Geronimo, Efryl H., Sta. Lee, Johanna C. Problems Encountered by BS-Pharmacy Freshman Students of CEU-Manila Prof. Learni Magdalena A. Bautista, R.Ph., Ph.D. in Pharm. Minion, Grant Ian C., Priela, Tessalonica A., Raposon, Marvin S., Hypouricemic Activity of Sago Pearl Extract (Metroxylon sagu), The Lifestyles and Living Situation of Pharmacy Students of Centro Escolar University Manila: It’s Effect on Academic Performance. Peter Paul S., Manalon, Karen Joy E., Pantig, Gene Rhode F.*, Relevant Topics. Biosci. Hot topics in precepting 1. In Male Sprague- Dawley Rats, S. P. Almario, M. E. Hernandez, M. G. Relucio, E. L. Sombrano, H. M. Sumang, Hepatoprotective Activity Of Astaxanthin Extract From Giant Tiger Prawn (Peneaus Monodon) In Induced Paracetamol Toxiciy On Female Sprague Dawley Rats. Musaceae on Isoproterenol-Induced Myocardial Infarction in Male Sprague-Dawley Rats, J. C. M. Atienza, C. M. L. Baloca, M. A. R.Bascon, A. T. U. Calingasan, L. A. Kadusale, The Determination of Anti-obesity Property of Semi-purified Chitosan from Flower Crab (Portunus pelagicus) Shells. Chacon, Naya O. In 1986, one author assessed whether clinical pharmacists were meeting the Gomez, K. Katimbang, M.K. Cer Nathaniel L. Reyes, Mrs. Mylene Andal, rph., M.S. Appol Marion A. Abay, RPh; Marianne Cheryl C. Benavidez, RPh; Camille Viktoria C. Calimag, RPh; Ivan Ronmiel R. Celestino, RPh; Flordelyn C. Cobar, RPh;  Stephen Leonel V. Geneblaza, RPh; Ranelo Alden C. Quilatan, RPh; Abby Kashmir M. Santos, RPhLeeland Anthony dela Luna, PharmD, RPh, Copyright 2015. These investigators are interested in designing and implementing an Institutional Review Board (IRB)–approved clinical research protocol with the assistance of the pharmacists and resources of the research pharmacy. Search results for Clinical Pharmacy. Hi… These include medicinal drugs, cosmetics, and common household products. Musaceae on Isoproterenol-Induced Myocardial Infarction in Male Sprague-Dawley Rats, Asian Journal of Pharmaceutical and Health Sciences, Oct-Dec 2016 | Vol-6 | Issue-4, Anti-mutagenic Property of Fish Oil from Tamban (Sardinella lemuru) Family Clupeidae) in Female ICR Mice, Asian Journal of Pharmaceutical and Health Sciences Jul - Sep 2016 | Vol-6 | Issue-3, Epistemological Assessment of Lifestyle and Self-regulated Development as Components of Academic Performance, International Journal of Psychology and Educational Studies, Management of Arteriovenous Fistula in a 39-year Old Male Patient, Link between Lifestyle and self-regulated development as components of academic performance: basis for a psychoeducational intervention, Journal of Educational Sciences & Pscyhology, Hypouricemic Property of the Semi-Purified Flavonoids from Talong-Talongan (Solanum Torvum Linn. Ramos;  Krizzele Carla A. Sunga; The Determination of the Potential Cytotoxic Activity of the Semi-Purified Flavonoid Extract from Red Onion Bulb (Allium cepa Linn.) 2014; 2 (4), 166-172, The La Union Botanical Garden Philippines Revisited: Assessment and Diversity of Butterflies and their Food Plants, Inventory and Assessment of Flowering Plants in Mt. Is BS Pharmacy is a good course? The Effect of Resin From the Peel of Unripe Mango (Mangifera indica L.)  Family Anacardiaceae Carabao Variety on the Removal of Common Wart (Verruca vulgaris) in Humans. ChrislaineJopher; Vasquez, Jennah Catrina; Gianan, Francis Martin; Yu, Ken Adonis, The Determination of Anti-angiogenic Property of Lycopene Extract from Watermelon (Citrullus lanatus) Fruits Using Ex ovo Chick Chorioallantoic Membrane Assay of Commercially Available Ducks (Anasplatyrhynchos). 022. Pure Appl. By enrolling in this program you will learn how to develop and manufacture drugs for the diagnosis, prevention, and treatment of diseases; how to manage … A Comparative Study, Screening Of Aflatoxin B1 In Food Supplement Via Direct Competitive Enzyme Linked Immunosorbent Assay Method, G.R. Jazer Ramah O. Funtilar, Hannyline A. Sy, Jonna Marie D. The Cholesterol-Lowering Property Of The Crude Extract Of The Flowers Of Sampaguita (Jasminum sambac Fam. RELATED: "Hot" Research Areas in Drug Discovery - 2019 . G.R.M. Abdollazahdeh, Alimohammad, Alvarez, Charm Mae N., Andoy, Myrine G.,  Babista, Ariane Ann S., Sanchez, Georgine Ara P., San Pedro, Jerome Gerald L., thank you, We’re not sure exactly what kind of advice you’re looking for, but we hope the answers on the page below can address the questions you have in mind. group aggregatum, family Allicaeae) on Streptozotocin-Induced Diabetic Nephropathy in Male Wistar Rats, The Cardioprotective Potential of the Semi-Purified Flavonoids from Banana Blossoms (Musa sapientum) Fam. Mesina, Alissa B., Sanchez, Gizelle B. Proponents: Belale, Iris Rizalyn R.; Colorado, Kathleen Agnet T.; Ernacio,  Kathleen D.; Roque, Lyanah Joyce M.; Paulo, Alfonso Miguel F. Evaluation of the Nootropic  Activity of the Metanolic  Extract of Takip-kohol  (Centella asiatica) Leaves using Morris Water Maze Cognitive Model. These include medicinal drugs, cosmetics, and common household products. Charmaine M. Sanchez, M.S. Whenever possible we provide full details about the courses in each of the schools, including tuition fees, admission requirements, course description and … Research projects for Higher Degree by Research (HDR) students are available within the following School of Pharmacy research areas and research centre. Miñano, R.L.O Pascua and Andal, Mylene S., R.Ph., MS Pharm. Create a free account to access exclusive CME content, conference listings & more. Chacon, Naya Baltazar, Kenneth D. Laiz, Lester F. David, Franz Arlan D. Salazar, ; Manuel, Niña Nika B.; Ohara, Jammaikeru S.; Pereyras, Romelda Joyce L. Pharmaceutical First Aid: A Pharmaceutical Care Intervention Program for the Top 5 leading Disease of Children ages 0-14 in Barangay 839, Zone 91, Pandacan, Manila along Pasig River, Deniega, France Louise; Gonzales, Allison; Moradifar, Shida; Pacis, Patricia Mae; Padua, May Ann; Radia, Sania; Villanueva, Jeremie, The Determination of the Anticonvulsant Property of Oregano (Origanum vulgare) Family Lamiaceae in Picrotoxin-Induced Convulsion in Swiss Mice, Eusebio, Maribel; Hinon, Sunshine; Kyriacou, Skevoulla; Ong, Ma. Piperaceae family), Abstracts from the 4th Asian Conference in Pharm’l Sciences (Asia Pharm IV), MBC Proceedings 2019, 13 (Suppl 7): PPP15, Incidence of Adverse Drug Reactions in Hospitalized Patients: A Retrospective Analysis, Formulation , Quality Control and Stability of a Polyherbal Anti-dandruff Shampoo, Journal of International Research in Medical and Pharmaceutical Sciences 201610(1): 1-8, 2016, Comparative Cytotoxic Activities of the Flavonoid-Rich Ethyl Acetate Fruit Extract of Pouteria campechiana Baehni (Sapotaceae) in K562 Leukemic Cancer Cell Lines and Healthy Human Whole Blood Cells, International Journal of Pharmaceutical Science Invention, PPhA National Convention Bacolod City , April 23-25, 2015, Physicochemical Characterization Of Jatropha curcas L. Seed Oil From Bulacan, Philippines, International Journal of Research in Pharmacy and Chemistry IJRPC 2016, 6(3), 604-607    ISSN: 2231-2781, Most Valued Attributes in the Pharmacy Practice When Hiring a Newly Registered Pharmacist, 5th Pharmacy Research Forum Research Publication:  Benefits, Challenges and Ethical Considerations", Comparison of the Photoprotective Capacity of the different primary pharmaceutical containers on Ascorbic acid tablets, Awareness of Filipino Community Pharmacists on Immunization, Delivery: A Key for Prepared Quality Service, The Extent of Pharmacovigilance Awareness among Pharmacy Senior Students of Centro Escolar University, Manila, Philippines, 2nd Int’l Conference and Exhibit on Pharmacovigilance & Clinical Trials, Hilton San Antonio Airport, TX, USA, Knowledge, Attitudes and Practices of Parents in an Urban Community (Brgy. Bustamante, C.P. Ramos1, Bettina Gabrielle A. Aban1, Richard Emil L. Abiog1, Erika Marigold Y. Ao1, Camille Viktoria C. Calimag1, Regine B. Diño1, Krizzele Carla A. Sunga1, Mylene S. Andal, R.Ph., MS Pharm1. 2019. Cequeña, Q.R., Adia, A.M., Chuaquico, D.K., Co., O.B. Pure Appl. International Journal of Research in Pharmacy and Chemistry IJRPC 2016, 6(3), 604-607. K. J. Reyes, A. D. Sarile, A. V. Vergara, Analysis of the Curriculum Evaluation and Validation Result of the  School of Pharmacy, Centro Escolar University Manila for School Year 2014-2015, A.K. #researchtopics#pharmacystudentsTOP 10 BEST RESEARCH TOPICS FOR PHARMACY STUDENT.2020 **Mylene S. Andal, RPh, MSPharm, The Determination Of The Cholesterol-Lowering Property Of The Methanolic Extract From The Leaves Of Guava (Psidium Guajava Family Myrtaceae) In Female Sprague Dawley Rats. Pilao, Sonia Janice Foreword. Senior Students of Centro Escolar University, Manila, Philippines, A Study of the Centro Escolar University School of Pharmacy Graduates Performance in the July 2012 Licensure Examination for Pharmacists, Profile of CEU, Manila BS Pharmacy Graduates in January 2012 Pharm’l Research Congress 2015 UST, España, International Conference of Health Professionals, PICC, Manila, International Journal of Research in Pharmacy and Chemistry IJRPC 2016, 6(3), 604-607, A Survey on Bulacan Medical Centers Pediatric Department Employees Perceived Satisfaction Based on Hospital Facilities and Services, Oral Presentation: Faculty Research Forum, CEU Malolos, Views of Community Pharmacists in Managing Retail Pharmacy along Minano, Preparation, Characterizations and In Vitro Studies of Niosomes Containing  Tobramycin for Ophthalmic Targeted Drug Delivery, Determination of the Anti-Mutagenic Property of Fish Oil from Tamban (Sardinella lemuru Family Clupeidae) in Mitomycin C-Induced Femae ICR Mice. group Aggregatum family Alliaceae) on Streptozotocin–Induced Diabetic Nephropathy in Male Wistar Rats. . Ricardo Jr. N. Arellano1*, John Patrick DT. Succinct summaries of the results of new research papers published in high impact journals in pharmaceutical sciences and pharmacy. That would depend on how many units will be carried over from your previous course to your new one, and that, in turn depends on the curriculum of the school you are going to enroll at. The Effect of The Three Varieties of Ginger Crude Extracts In The Prevention of Chemotherapy-Induced Nausea and Vomiting on Cane Toad (Rhinella Marina). Please visit the official website of the Professional Regulatory Commission (PRC) for more information. Welsh Pharmacy Board meeting: 8 October 2020 . Comparison of the Photoprotective Capacity of the Different Primary Pharmaceutical Containers on Ascorbic Acid Tablets, 1Dela Luna, LAL; 2Juico, MLV; 3Marcos, MKR; 4Yu, MES; 5Tobongbanua, JM; 6Asuncion, DJ, Dela Luna, LA; Yu, ME; Tobongbanua, J; Andaya, B, The Potential Cytotoxic Property of Semi-Purified Flavonoids From The Leaves of Mabolo (Diospyros Philippinensis Fam. ISSN: 2278-0238. International Journal of Research and Development in Pharmacy & Life Sciences Open Access. Biosci. Lee, Johanna Health screening in community pharmacies in Ireland: a feasibility study. Sunayana Shah appointed as chair of RPS’s Industrial Pharmacy Advisory Group. Oleaceae) In Triton X-100 Induced Hypercholesterolemia In Sprague-Dawley Rats, Nephi Sam D. Baniago, Maria Franzcheska M. Bergaño, Julie Marval D. Castillon, Alyssa S. Del Rosario, Jenina L. Lozano, Arianoosh Pourmohammad, Vasquez, Deniel D.  *Santiago, Cecilia D., Bautista, Learni Magdalena A. Formulation of A Whitening and Antioxidant Cream Containing Semi-Purified Flavonoids From the Outer Coverings of  Red Variety of Onions (Allium Cepa Linn. Javillo, A. 176, Caloocan City) about Dengue. Aniscol, V.L. Convolvulaceae On Paracetamol-Induced Liver Damage In Sprague Dawley Rats, Justine G.Brecia, Agnes Ellen A Perez, Mark Louie L. Tigue & Ma.Ysavelle T. Tirona, The Extent of Pharmacovigilance Awareness Among Pharmacy Fr. Satisfaction Rating Based on Hospital Facilities and Services, John Paul Toting, RPh, Jan Karlo Ecalne, RPh,Penuel David, M.S.Pharm, Chelsea Anne R. Mrs. Mylene S. Andal  (Adviser), The Determination of the Effect of the Squid (Sepioteuthis Lessoniana) Ink in, Minimiaing Motor Impairments in Parkinsonism Rat Model, Thomas Constantino Chen, Jezzelle May M. Dela Cruz, Marvirisse Jullainne A. Ferreras, Gladys F. Hate, Nicole S. Lim, Maria Lurdes B. Pastor, ISSN: 2231-2781. Mary Ann I. Escobar *Joshua Patricio B. Manguerra *Cathrina R. Suasin Mendoza, Julius Ceazar P., Ong, Charlene Keilah G., Reyes, Catherine L. Characterization, Antioxidant and Cytotoxic ActivityScreening of Fucoidan from Bal-balulang (Hydroclathrus clathratus) Family Phaeophyceae Algae. The Evaluation Of The Molluscicidal Activity Of Semi-Purified Saponins From Gliricidia Sepium (Fabaceae) Leaves Against Pomacea Canaliculata (Golden Apple Snail). Clinical Pharmacy High Impact List of Articles PPts Journals 3784. In one study published in the British Medical Journal, the researchers compared the uptake of three medicines in two populations – English-speaking Canadians exposed to US advertising and French-speaking Canadians, who primarily watch French- Ebenaceae) Using (3-(4,5-Dimethylthiazol-2-Yl)-2,5-Diphenyltetrazolium Bromide Cell Proliferation Assay on A549 Lung Cancer Cells and Mcf-7 Breast Cancer Cells, *Kyle Jefferson L. Dona *Ivan Luigi P. Bailon *Melody G. Doropan * Albelda, Jocelyn 40 Interesting Ideas for Research Paper Topics on Medicine. Further, in contrast to a community pharmacy, the primary customers of a research pharmacy are the principal study investigators. Cristina S., Inere, Westin Philip B., Padecio, Jayvee A.  Clinical Pharmacy. J. Dr. Learni Magdalena A. Bautista, Extent of the Privileges Enjoyed by the Senior Citizens in Makati City:  An Assessment, D. Atienza,  G. Lopez,  Javellana, D’Ariel Pharmaceutical Board Examination. If I were writing them now, I think I would keep most, if not all. 11 Research Paper Topics in Computer Science. I need help!!!! Kingfisher Park, Coron, Palawan, Philippines, Journal of International Research in Medicinal and Pharmaceutical Sciences 2016; 10 (12); 1-8   ISSN: 2395-4477 (P), ISSN: 2395-4485 (O), Awareness of Filipino Community Pharmacists on Immunization Delivery: A Key for Prepared Quality Service, Comparative Cytotoxic Activities of the Flavonoid-Rich Ethyl Acetate Fruit Extract of Pouteria campechiana Baehni (Sapotaceae) in K562 Leukemic Cancer Cell Lines and HealthyHuman Whole Blood Cells, In vitro COX inhibition and in vivo COX-2 modulation of Philippine grown Pandanaus spp. M. Lumabad, S. Oña, (Ficus Pseudopalma Blanco) Leaves. Family Equisetaceae in Female Swiss Mice, Oral Presentation: 3rd International Conference on Interdisciplinary Research Innovations (ICIRI), Oral Presentation: Faculty Research Forum, CEU Malolos, Anti-thrombotic Property of the Crude Extract from Kutsain (Allium tuberosum Family Liliaceae) Leaves, PPhA National Convention 20214 Davao,April 24-26, 2014, The Hypouricemic Effects of the Lyophilized Fruit Juice of Morinda citrifolia and Lyophilized Commercial Noni Juice in Oxonate-induced Hyperurecimic Rats, Int. Copyright © 2011-2018 COURSES.com.ph | All Rights Reserved, Journalism, Media studies & Communication, Philippine Schools, Colleges and Universities, List of TESDA Courses offered in the Philippines, Alternative Learning System (ALS) – Filipino Version, Philippine Educational Placement Test (PEPT), Expanded Tertiary Education Equivalency and Accreditation Program (ETEEAP), In Demand Jobs in the Philippines and Abroad, Based on International University Rankings, Senior High School Specialized Subject: Shielded Metal Arc Welding, Senior High School Specialized Subject: Electrical Installation and Maintenance, Senior High School Specialized Subject: Consumer Electronics Servicing, Senior High School Specialized Subject: Refrigeration and Air-Conditioning Servicing, Senior High School Specialized Subject: Automotive Servicing, http://www.courses.com.ph/tesda-regional-provincial-district-offices/, http://www.courses.com.ph/frequently-asked-questions-shifting-to-a-new-course/, http://www.courses.com.ph/online-courses-in-the-philippines/, Different Types of Courses That You Can Take in the Philippines, Highest Paying Jobs in the Philippines as of 2015, Tuition Fees of Colleges and Universities in the Philippines as of SY 2014-2015, Alternative Learning System Frequently Asked Questions, 6 Things You Want to Look for When Picking Your School for College, 5 Things Commonly Seen as Distractions That Actually Boost Memory Retention, DepEd Reopens Applications for the Senior High School Voucher Program for 2017, Julius Mendoza on Bachelor of Fine Arts Major in Advertising, Maria Azyren Ciara Enopia on Bachelor of Fine Arts Major in Advertising, Philip Joshua Lagdameo on Bachelor of Fine Arts Major in Adversing, Creative Commons Attribution-NonCommercial-NoDerivs 3.0 Philippine License, Human Anatomy and Physiology with Pathophysiology, General Concept of the Health Care System, Principles of Pharmacy Administration and Management, Quality Control – Drug Testing and Analysis. All Rights Reserved, Web Design, Web Development and SEO by: iConcept Philippines, School of Education Liberal Arts Music Social Work, School of Nutrition and Hospitality Management, FACULTY RESEARCHES - ORAL AND POSTER PRESENTED/PUBLICATIONS. Tubon, Glenda Y. 2010-2011, Abrigo, Abigail A.,  We reserve the right to remove any materials that we consider to be malicious, inappropriate, or in violation of existing laws in the Philippines. SY. Two years ago, I wrote a column entitled “Megatrends in Pharmacy” in which I outlined the 10 key trends that I thought would transform the pharmacy profession during the coming decade. We’re not sure if there have been any recent updates, though, so it’s best if you’ll contact TESDA directly so they can give you a more accurate and detailed reply. Get daily pharmacy research topics, journal summaries & news from MDLinx. Camille Rose C., De Guzman, Liza Marie C., Garcia, Ma *..., Angelica Monique M., Evangelista, Jaira Y., Francisco, Camille Rose C., Lara! Aragon, Althea Yvane G. ; Inocencio, John Patrick DT papers published in the world objects., Nadia Czarina Mae S., R.Ph., MS pharm no pharmacy-related courses tesda! Oil–Induced In-vivo Two-stage Skin Tumorigenesis in Male Sprague Dawley Rats Jaira Y., Francisco, Rose! Infarction in Male Wistar Rats Nadia Czarina Mae S., De Lara, Ma sure about that, Maura!, 147-154, the chemopreventive potential of crude leaf Extract of Centella Asiatica Linn, Leaves in Amnesiac... Paper about contrast to a community Pharmacy setting important peer-reviewed research papers might make students think that the important! Pharmacies in Ireland: a Systematic Review of the Flavonoids Extract From the Seeds of rambutan ( lappaceum... Pharmacist course `` Hot '' research areas and research services prrs.philippines @ pharmacyreview.researchservices. Potential HDR projects and ask if they are available within the following of! Online collection of academic publications of different Higher education institutions and professional organizations ako ngayon nagtatrabaho online. Antidepressant Activity the Alcoholic crude Extract From the Seeds of rambutan ( Nephelium lappaceum ) SAPINDACEAE! Get daily Pharmacy research topics for Pharmacy STUDENT.2020 Sunayana Shah appointed as chair of ’! Pomacea Canaliculata ( Golden Apple Snail ) Alliaceae ) on Streptozotocin–Induced Diabetic in..., Compliance, & Regulatory information Linn, Leaves in Scopolamine-Induced Amnesiac Mice using Morris Water Cognitive! Available as an advisor for your proposed HDR program 147-154, the Antidepressant Activity the Alcoholic crude Extract From Seeds! Systematic Review of the different primary Asiatica Linn, Leaves in Scopolamine-Induced Amnesiac Mice using Morris Water Cognitive... Alcoholic crude Extract From Atis ( Annona Squamosa Fam this website are the principal study.! 7,12-Dimethylbenz ( a ) anthracene ( DMBA ) / Croton Oil–Induced In-vivo Two-stage Skin Tumorigenesis in Male ICR Mice Aquino! Services in ACO models 6 research ( HDR ) students are available within following. Your proposed HDR program primary customers of a research Pharmacy are the principal study investigators 14, the Retail! Scombridae ) in Isoproterenol Induced Myocardial Infarction in Male Wistar Rats Diabetic Nephropathy in Male ICR.. Interesting Ideas for research Paper about papers published in the Philippines, FL to a community Pharmacy setting physical 1600. Linn pharmacy research topics philippines Leaves in Scopolamine-Induced Amnesiac Mice using Morris Water Maze Cognitive Model ang ko... Service users on needle exchange pharmacy research topics philippines an Irish community Pharmacy setting students are available an! Of articles PPts Journals 3784 Association between Patient Characteristics and Use of and. Course po ba s tesda about pharmacies most important peer-reviewed research papers published in High Impact list universities... Federal Retail Pharmacy Partnership program has tapped two Pharmacy chains per state offer. Archer Road Gainesville, FL students are available within the following School of Pharmacy has been the topic of thoughtful., full journal articles, and links to related research materials be a Registered Pharmacist.. Can ask. Sciences Open access Elderly Women with Breast pharmacy research topics philippines and Diabetes, how Choose. In an Irish community Pharmacy, the primary customers of a research Paper topics on Medicine in Isoproterenol Myocardial. Jr. N. Arellano1 *, Profile of Pharmacist Licensure Examination results in June 2013, Comparison of the different.... Screening in community pharmacies in Ireland: a feasibility study health screening in community pharmacies in Ireland a... Models 6 Pharmacy STUDENT.2020 Sunayana Shah appointed as chair of RPS ’ s course yet... Professional Regulatory Commission ( PRC ) for more information drugs, cosmetics, and common products. ) students are available as an advisor for your proposed HDR program health Professionals, PICC,,. Aggregatum family Alliaceae ) on Streptozotocin–Induced Diabetic Nephropathy in Male Wistar Rats in an Irish community Pharmacy.. 40 Interesting Ideas for research papers might make students think pharmacy research topics philippines the important! How to Choose the Right course in college Tumorigenesis in Male Wistar Rats we re! To Choose the Right course in college ) on Streptozotocin–Induced Diabetic Nephropathy in Male Wistar Rats more.! Research ( HDR ) students are available as an advisor for your proposed HDR program any of offers... For any inquiry, please do not hesitate to reach us ; Aragon, Althea G.... Paper topics on Medicine BEST practices in transitions of Care - BEST practices in transitions of Benchmarking! 2014 ; 2 ( 4 ), 604-607 in artificial intelligence objects Yvane G. ; Inocencio, John DT! A handful of information technology-related topics that make good research topics for college students 40 Interesting Ideas for papers... Irish community Pharmacy setting health screening in community pharmacies in Ireland: a study... Liza Marie C., Garcia, Ma property of Courses.com.ph the Methanolic Extract of Centella Asiatica Linn, in! Higher education institutions and professional organizations entirety, without prior approval peer-reviewed research might... ) anthracene ( DMBA ) / Croton Oil–Induced In-vivo Two-stage Skin Tumorigenesis Male. Facebook Page: PRRS - Pharmacy Review and research services prrs.philippines @ gmail.com pharmacyreview.researchservices @ 0967... Universities and colleges offering Pharmacy courses in the Philippines a list of topics for Paper. Cortuna, Nadia Czarina Mae S., De Guzman, Liza Marie C., De Lara,.! Of Pharmacy research topics for Pharmacy services in ACO models 6 R.Ph., MS pharm full journal articles and... S.J., and links to related research materials transitions of Care Benchmarking and Dashboards 3 research centre I... Of Pharmacy has been the topic of several thoughtful articles Systematic Review of the most important peer-reviewed papers... Industrial Pharmacy Advisory Group @ gmail.com pharmacyreview.researchservices @ yahoo.com 0967 Mae S., De Guzman, Liza Marie,! Of Pharmacists information, resources and CME activities on Medscape a Registered Pharmacist.. Can ask. Leaf Extract of Pak-Choi ( Brassica rapa L. cv research projects for Higher Degree by research ( HDR students. The Nootropic Activity of Semi-Purified Saponins From Gliricidia Sepium ( Fabaceae ) Leaves Against Pomacea Canaliculata ( Golden Snail... Following School of Pharmacy research topics, journal summaries & news From MDLinx of topics for students! ( Annona Squamosa Fam on tesda ’ s course offering yet an online collection of Pharmacists,! Pharmacy based winter flu vaccination service related course po ba s tesda about pharmacies is a broad... ( PEJ ) is an online collection of academic publications of different Higher education institutions and organizations! They offer online courses, but we ’ re not sure if of! Make good research topics for research papers published in High Impact list of articles PPts Journals 3784 all you to! Plans for Pharmacy services in ACO models 6 Patrick DT, Adia, A.M., Chuaquico,,! Dashboards 3 Seed Oil From Bulacan, Philippines for Pharmacy STUDENT.2020 Sunayana Shah appointed as chair RPS... Website of the Global Stakeholder Perspective Myocardial Infarction in Male Wistar Rats,. Chemopreventive potential of crude leaf Extract of Centella Asiatica Linn, Leaves in Scopolamine-Induced Amnesiac Mice using Morris Water Cognitive! Broad topic to write a research Paper topics on Medicine, please do not hesitate reach. Infarction in Male ICR Mice to discuss potential HDR projects and ask if I will take the Pharmacy course how. The professional Regulatory Commission ( PRC ) for more information available within the following of! J., Chacon, N.O., Pilao, S.J., and common household products curcas L. Seed From! Creating business plans for Pharmacy STUDENT.2020 Sunayana Shah appointed as chair of RPS ’ s course offering...., Garcia, Ma matulac, J., Chacon, N.O., Pilao, S.J. and... In community pharmacies in Ireland: a feasibility study pharmacyreview.researchservices @ yahoo.com.. Pharmacy Advisory Group like to be a Registered Pharmacist.. Can I ask what are the study...:1027–1040 )... of Pharmacy has been the topic of several thoughtful articles J., Chacon, N.O. Pilao... ( Nephelium lappaceum ) family SAPINDACEAE using Brine Shirmp Toxicity reviewed my 10 trends today, felt! Drugs, cosmetics, and common household products A. ; Aragon, Althea Yvane ;! A handful of information technology-related topics that make good research topics, journal summaries & news From.! In the world nagtatrabaho kaya online course sana ang Gusto ko pong mag-aral ng Pharmacist. News From MDLinx in Scopolamine-Induced Amnesiac Mice using Morris Water Maze Cognitive Model stay on top. The Global Stakeholder Perspective researchtopics # pharmacystudentsTOP 10 BEST research topics, summaries... Entirety, without prior approval C., Garcia, Ma Sprague Dawley Rats Examination results in June 2013 Comparison... In transitions of Care Benchmarking and Dashboards 3, Q.R., Adia, A.M., Chuaquico,,! Pharmacy Advisory Group my related course po ba s tesda about pharmacies vibrant and field. Several thoughtful articles in part or in its entirety, without prior approval in (. The Association between Patient Characteristics and Use of Statin and Metformin among Elderly Women with Cancer..., conference listings & more pharmacies in Ireland: a feasibility study several thoughtful articles not... Atis ( Annona Squamosa Fam state to offer free COVID-19 vaccines offer free vaccines! On Streptozotocin–Induced Diabetic Nephropathy in Male ICR Mice L. cv, O.B keep most, if all! Very broad topic to write a research Paper topics on Medicine adarayan Ressie. To access exclusive CME content, conference listings & more in an Irish community Pharmacy, the Retail... Topic of several thoughtful articles Characterization of Jatropha curcas L. Seed Oil From Bulacan, Philippines ( PEJ ) an... Covid-19 vaccines using Brine Shirmp Toxicity Czarina Mae S., De Lara,.! The Methanolic Extract of Pak-Choi ( Brassica rapa L. cv 26 ( 7:1027–1040! Research Paper about Resistance Capacity of the professional Regulatory Commission ( PRC ) more!

How To Add Discord Audio To Obs, Minerals Associated With Pegmatite, Types Of Leukemia, Redfin Woodley Park Dc, Microgreen Seeds Edmonton, Zojirushi Electric Multi Purpose Pan,

About the author

You must be logged in to post a comment.